PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC12925_p1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family bHLH
Protein Properties Length: 90aa    MW: 10082.2 Da    PI: 8.5328
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC12925_p1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH25.42.6e-0817571454
                 HHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHH CS
          HLH 14 driNsafeeLrellPkaskapskKlsKaeiLekAveYIksL 54
                 d+i +   +L+ l+P++ + +s+K+s +++L++++ YI++L
  RrC12925_p1 17 DQISDLVRKLQHLIPELRRRRSGKVSASTVLQETCSYIRNL 57
                 68899999********88*********************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5088810.69357IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PfamPF000107.8E-61757IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene3DG3DSA:4.10.280.109.1E-91771IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SuperFamilySSF474592.75E-91776IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 90 aa     Download sequence    Send to blast
MSSGRSRQSG SSRISDDQIS DLVRKLQHLI PELRRRRSGK VSASTVLQET CSYIRNLHRE  60
VDDLSDRLSE LLASTDDNSA EAAIIRSLLN
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
12336RKLQHLIPELRRRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1191101e-103AK119110.1 Arabidopsis thaliana mRNA for unknown protein, complete cds, clone: RAFL21-46-D20.
GenBankBT0046861e-103BT004686.1 Arabidopsis thaliana At1g26948 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013690768.19e-43PREDICTED: transcription factor PRE6-like
RefseqXP_013595899.19e-43PREDICTED: transcription factor PRE6
SwissprotQ8GW322e-44PRE6_ARATH; Transcription factor PRE6
TrEMBLA0A078GTH81e-42A0A078GTH8_BRANA; BnaC07g12550D protein
TrEMBLA0A0D3D6W81e-42A0A0D3D6W8_BRAOL; Uncharacterized protein
STRINGAT1G26945.14e-42(Arabidopsis thaliana)
STRINGBra024672.1-P4e-42(Brassica rapa)
STRINGfgenesh2_kg.1__2658__AT1G26945.14e-42(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM25928225
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26945.15e-41bHLH family protein